« Zurück
Startseite /
Recombinant Macaca fascicularis Chymase(CMA1)

Recombinant Macaca fascicularis Chymase(CMA1)

ArtNr	CSB-EP005599MOV-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	IIGGTECKPHSRPYMAYLEIVTSNGPSKSCGGFLI RRNFVLTAVHCAGRSITVTLGAHNITEKEDTWQKL EVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAV GTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDT LQEVKLRLMDPQACSHFRYFDHNLQLCVGNPRKTK SAFKGDSGGPLLCAGVAQGIVSYGRLDAKPPAVFT RISHYRPWINKILQAN
Protein Familie	Peptidase S1 family, Granzyme subfamily
Citations	"Induction of chymase that forms angiotensin II in the monkey atherosclerotic aorta."Takai S., Shiota N., Kobayashi S., Matsumura E., Miyazaki M.FEBS Lett. 412:86-90(1997) .
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Alpha-chymase
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	41.1 kDa
Relevance	Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion.
Expression Region	22-247aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
Subcellular Location	Secreted, Cytoplasmic granule
Gene Names	CMA1
Sequence Info	Full Length of Mature Protein
Organism	Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP005599MOV-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 28.08.2025