« Zurück
Startseite /
Recombinant Mouse Desmoglein-3(Dsg3),partial

Recombinant Mouse Desmoglein-3(Dsg3),partial

ArtNr	CSB-EP007205MO-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	EWVKFAKPCREREDNSRRNPIAKITSDFQKNQKIT YRISGVGIDQPPFGIFVVDPNNGDINITAIVDREE TPSFLITCRALNALGQDVERPLILTVKILDVNDNP PIFSQTIFKGEIEENSASNSLVMILNATDADEPNH MNSKIAFKIVSQEPAGMSMFLISRNTGEVRTLTSS LDREQISSYHLVVSGADNDGTGLSTQCECSIKIKD VNDNFPVLRESQYSARIEENTLNAELLRFQVTDWD EEY
Citations	"cDNA cloning and chromosomal assignment of the mouse gene for desmoglein 3 (Dsg3), the pemphigus vulgaris antigen."Ishikawa H., Silos S.A., Tamai K., Copeland N.G., Gilbert D.J., Jenkins N.A., Uitto J.Mamm. Genome 5:803-804(1994)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	130KDA pemphigus vulgaris antigen homolog
Lieferbar
Manufacturer - Targets	Dsg3
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	79.2 kDa
General Research Areas	Signal Transduction
Relevance	Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion.
Expression Region	50-617aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion.
Subcellular Location	Cell membrane, Single-pass type I membrane protein, Cell junction, desmosome
Tissue Specificity	Expressed in epidermis.
Biologically active	Not Test
Protein length	Extracellular Domain

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP007205MO-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern