« Zurück
Startseite /
Recombinant Human Eukaryotic translation initiation factor 4 gamma 1(EIF4G1),partial

Recombinant Human Eukaryotic translation initiation factor 4 gamma 1(EIF4G1),partial

ArtNr	CSB-EP007568HUb9-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	IEEYLHLNDMKEAVQCVQELASPSLLFIFVRHGVE STLERSAIAREHMGQLLHQLLCAGHLSTAQYYQGL YEILELAEDMEIDIPHVWLYLAELVTPILQEGGVP MGELFREITKPLRPLGKAASLLLEILGLLCKSMGP KKVGTLWREAGLSWKEFLPEGQDIGAFVAEQKVEY TLGEESEAPGQRALPSEELNRQLEKLLKEGSSNQR VFDWIEANLSEQQIVSNTLVRALMTAVCYSAIIFE TPL
Protein Familie	Eukaryotic initiation factor 4G family
Citations	"A newly identified N-terminal amino acid sequence of human eIF4G binds poly(A)-binding protein and functions in poly(A)-dependent translation." Imataka H., Gradi A., Sonenberg N. EMBO J. 17:7480-7489(1998)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	p220
Lieferbar
Manufacturer - Targets	EIF4G1
Manufacturer - Conjugate / Tag	N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	46.6 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Component of the protein complex eIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure and recruitment of mRNA to the ribosome.
Expression Region	1250-1599aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Component of the protein complex eIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure and recruitment of mRNA to the ribosome.
Involvement in disease	Parkinson disease 18 (PARK18)
Biologically active	Not Test
Protein length	Partial

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP007568HUb9-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern