« Zurück
Home /
Recombinant Glycine max Gamma-glutamyl hydrolase

Recombinant Glycine max Gamma-glutamyl hydrolase

Hersteller	Cusabio
Kategorie	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP009389GGV-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	P93164
Gene Names	N/A
Organism	Glycine max (Soybean) (Glycine hispida)
AA Sequence	ATSHDDHIFLPSQLHDDDSVSCTATDPSLNYKPVI GILTHPGDGASGRLSNATGVSYIAASYVKFVESGG ARVIPLIYNESPENLNKKLDLVNGVLFTGGWAVSG PYLDTLGNIFKKALERNDAGDHFPVIAFNLGGNLV IRIVSEQTDILEPFTASSLPSSLVLWNEANAKGSL FQRFPSDLLTQLKTDCLVLHNHRYAISPRKLQYNT KLSDFFEILATSGDRDGKTFVSTARGRKYPVTVNL WQPEKNAFEWATSLKAPHTEDAIRVTQSTANFFIS EARKSTNTPDAQKVRDSLIYNYKPTFGGTAGKGYD QVYLFE
Expression Region	22-342aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	51.3 kDa
Alternative Name(s)	Conjugase GH Gamma-Glu-X carboxypeptidase
Relevance	Hydrolysis of a gamma-glutamyl bond.
Reference	"Purification and molecular analysis of an Extracellular domain gamma-glutamyl hydrolase present in young tissues of the soybean plant." Huangpu J., Pak J.H., Burkhart W., Graham M.C., Rickle S.A., Graham J.S.Biochem. Biophys. Res. Commun. 228:1-6(1996).
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Secreted, extracellular space, Secreted, cell wall
Protein Families	Peptidase C26 family
Tissue Specificity	Expressed only in young (1-15 day old) leaf, stem and root tissue.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen