Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP009389GGV-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Signal Transduction |
Uniprot ID |
P93164 |
Gene Names |
N/A |
Organism |
Glycine max (Soybean) (Glycine hispida) |
AA Sequence |
ATSHDDHIFLPSQLHDDDSVSCTATDPSLNYKPVI GILTHPGDGASGRLSNATGVSYIAASYVKFVESGG ARVIPLIYNESPENLNKKLDLVNGVLFTGGWAVSG PYLDTLGNIFKKALERNDAGDHFPVIAFNLGGNLV IRIVSEQTDILEPFTASSLPSSLVLWNEANAKGSL FQRFPSDLLTQLKTDCLVLHNHRYAISPRKLQYNT KLSDFFEILATSGDRDGKTFVSTARGRKYPVTVNL WQPEKNAFEWATSLKAPHTEDAIRVTQSTANFFIS EARKSTNTPDAQKVRDSLIYNYKPTFGGTAGKGYD QVYLFE |
Expression Region |
22-342aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
51.3 kDa |
Alternative Name(s) |
Conjugase GH Gamma-Glu-X carboxypeptidase |
Relevance |
Hydrolysis of a gamma-glutamyl bond. |
Reference |
"Purification and molecular analysis of an Extracellular domain gamma-glutamyl hydrolase present in young tissues of the soybean plant." Huangpu J., Pak J.H., Burkhart W., Graham M.C., Rickle S.A., Graham J.S.Biochem. Biophys. Res. Commun. 228:1-6(1996). |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Subcellular Location |
Secreted, extracellular space, Secreted, cell wall |
Protein Families |
Peptidase C26 family |
Tissue Specificity |
Expressed only in young (1-15 day old) leaf, stem and root tissue. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.