Comparison

Recombinant Glycine max Gamma-glutamyl hydrolase

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP009389GGV-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
Conjugase
GH
Gamma-Glu-X carboxypeptidase
AA Sequence
ATSHDDHIFLPSQLHDDDSVSCTATDPSLNYKPVI GILTHPGDGASGRLSNATGVSYIAASYVKFVESGG ARVIPLIYNESPENLNKKLDLVNGVLFTGGWAVSG PYLDTLGNIFKKALERNDAGDHFPVIAFNLGGNLV IRIVSEQTDILEPFTASSLPSSLVLWNEANAKGSL FQRFPSDLLTQLKTDCLVLHNHRYAISPRKLQYNT KLSDFFEILATSGDRDGKTFVSTARGRKYPVTVNL WQPEKNAFEWATSLKAPHTEDAIRVTQSTANFFIS EARKSTNTPDAQKVRDSLIYNYKPTFGGTAGKGYD QVYLFE
Research Topic
Signal Transduction
Uniprot ID
P93164
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
22-342aa
MW of Fusion Proten
51, 3
Sequence Info
Full Length
Relevance
Hydrolysis of a gamma-glutamyl bond.
Reference
"Purification and molecular analysis of an Extracellular domain gamma-glutamyl hydrolase present in young tissues of the soybean plant."
Huangpu J., Pak J.H., Burkhart W., Graham M.C., Rickle S.A., Graham J.S.Biochem. Biophys. Res. Commun. 228:1-6(1996).
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Glycine max (Soybean) (Glycine hispida)
Amount: 10ug
Available: In stock
Listprice: €246.81
Price: €246.81
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close