« Zurück
Startseite /
Recombinant Rat Insulin-like growth factor-binding protein 1(Igfbp1)

Recombinant Rat Insulin-like growth factor-binding protein 1(Igfbp1)

ArtNr	CSB-EP011095RAe1-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Kategorie	Oncology Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	APQPWHCAPCTAERLELCPPVPASCPEISRPAGCG CCPTCALPLGAACGVATARCAQGLSCRALPGEPRP LHALTRGQGACVLEPAAPATSSLSGSQHEEAKAAV ASEDELAESPEMTEEQLLDSFHLMAPSREDQPILW NAISTYSSMRAREITDLKKWKEPCQRELYKVLERL AAAQQKAGDEIYKFYLPNCNKNGFYHSKQCETSLD GEAGLCWCVYPWSGKKIPGSLETRGDPNCHQYFNV QN
Citations	"The gene encoding rat insulin-like growth factor-binding protein 1 is rapidly and highly induced in regenerating liver." Mohn K.L., Melby A.E., Tewari D.S., Laz T.M., Taub R.A. Mol. Cell. Biol. 11:1393-1401(1991)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	Tag-Free
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	26.9 kDa
General Research Areas	Signal Transduction
Relevance	IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration
Expression Region	26-272aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration (By similarity).
Subcellular Location	Secreted
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP011095RAe1-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern