« Zurück
Startseite /
Recombinant Human Kynurenine 3-monooxygenase(KMO)

Recombinant Human Kynurenine 3-monooxygenase(KMO)

ArtNr	CSB-EP012475HUb0-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQID VYEAREDTRVATFTRGRSINLALSHRGRQALKAVG LEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQY ILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCN PEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRS HLMKKPRFDYSQQYIPHGYMELTIPPKNGDYAMEP NYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFE KLL
Protein Familie	Aromatic-ring hydroxylase family, KMO subfamily
Citations	"Structural and mechanistic basis of differentiated inhibitors of the acute pancreatitis target kynurenine-3-monooxygenase." Hutchinson J.P., Rowland P., Taylor M.R.D., Christodoulou E.M., Haslam C., Hobbs C.I., Holmes D.S., Homes P., Liddle J., Mole D.J., Uings I., Walker A.L., Webster S.P., Mowat C.G., Chung C.W. Nat. Commun. 8:15827-15827(2017)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Kynurenine 3-hydroxylase
Lieferbar
Manufacturer - Targets	KMO
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	61.9 kDa
General Research Areas	Metabolism
Relevance	Catalyzes the hydroxylation of L-kynurenine to form 3-hydroxy-L-kynurenine. Required for synthesis of quinolinic acid, a neurotoxic NMDA receptor antagonist and potential endogenous inhibitor of NMDA receptor signaling in axonal targeting, synaptogenesis and apoptosis during brain development. Quinolinic acid may also affect NMDA receptor signaling in pancreatic beta cells, osteoblasts, myocardial cells, and the gastrointestinal tract.
Expression Region	1-486aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). Required for synthesis of quinolinic acid, a neurotoxic NMDA receptor antagonist and potential endogenous inhibitor of NMDA receptor signaling in axonal targeting, synaptogenesis and apoptosis during brain development. Quinolinic acid may also affect NMDA receptor signaling in pancreatic beta cells, osteoblasts, myocardial cells, and the gastrointestinal tract.
Subcellular Location	Mitochondrion outer membrane, Multi-pass membrane protein
Tissue Specificity	Highest levels in placenta and liver. Detectable in kidney.
Biologically active	Not Test
Protein length	Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP012475HUb0-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern