« Zurück
Home /
Recombinant Mouse Lymphocyte antigen 96(Ly96)

Recombinant Mouse Lymphocyte antigen 96(Ly96)

Hersteller	Cusabio
Kategorie	Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Neurodegeneration Markers;Products Peptides & Proteins Recombinant Proteins general
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP013254MO-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Immunology
Uniprot ID	Q9JHF9
Gene Names	Ly96
Organism	Mus musculus (Mouse)
AA Sequence	EKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIR LRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELP KRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEG ILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRD VN
Expression Region	19-160aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	32.4 kDa
Alternative Name(s)	Short name: Ly-96 Alternative name(s): ESOP-1 Protein MD-2
Relevance	Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both MD2 and TLR4, but not TLR4 alone, respond to LPS
Reference	"ESOP-1, a secreted protein expressed in the hematopoietic, nervous, and reproductive systems of embryonic and adult mice."Kato K., Morrison A.M., Nakano T., Tashiro K., Honjo T.Blood 96:362-364(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds bacterial lipopolysaccharide (LPS)
Subcellular Location	Secreted, extracellular space, Secreted
Tissue Specificity	Highly expressed in spleen, bone marrow, thymus, liver, kidney, ovary and decidua. Detected at lower levels in testis, small intestine and skin.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP013254MO-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen