« Zurück
Home /
Recombinant Human Proliferation marker protein Ki-67(MKI67),partial

Recombinant Human Proliferation marker protein Ki-67(MKI67),partial

Hersteller	Cusabio
Kategorie	Oncology Neuroscience Neural Lineage Markers Neural Development Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Bladder Cancer Breast Cancer Adhesion Molecule Markers
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	100ug
Host	E.coli
ArtNr	CSB-EP014597HU(A5)-100
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Cancer
Uniprot ID	P46013
Gene Names	MKI67
Organism	Homo sapiens (Human)
AA Sequence	TKRHLRTRVQKVQVKEEPSAVKFTQTSGETTDADK EPAGEDKGIKALKESAKQTPAPAASVTGSRRRPRA PRESAQAIEDLAGFKDPAAGHTEESMTDDKTTKIP CKSSPELEDTATSSKRRPRTRAQKVEVKEELLAVG KLTQTSGETTHTDKEPVGEGKGTKAFKQPAKRKLD AEDVIGSRRQPRAPKEKAQPLEDLASFQELSQTPG HTEELANGAADSFTSAPKQTPDSGKPLKISRRVLR APKVEPVGDVVSTRDPVKSQSKSNTSLPPLPFKRG GGKDGSVTGTKRLRCMPAPEEIVEELPASKKQRVA PRARGKSSEPVVIMKRSLRTSAKRIEPAEELNSND MKTNKEEHKLQDSVPENKGISLRSRRQNKTEAEQQ ITEVFVLAERIEINRNEKKPMKTSPEMDIQNPDDG ARKPIPRDKVTENKRCLRSARQNESSQPKVAEESG GQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQP AASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKK IRTRSHRDSEDI
Expression Region	2720-3256aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	75.1 kDa
Relevance	Thought to be required for maintaining cell proliferation.
Reference	The cell proliferation-associated antigen of antibody Ki-67: a very large, ubiquitous nuclear protein with numerous repeated elements, representing a new kind of cell cycle-maintaining proteins.Schlueter C., Duchrow M., Wohlenberg C., Becker M.H.G., Key G., Flad H.-D., Gerdes J.J. Cell Biol. 123:513-522(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly
Subcellular Location	Chromosome, Nucleus, Nucleus, nucleolus
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen