« Zurück
Startseite /
Recombinant Human Proliferation marker protein Ki-67(MKI67),partial

Recombinant Human Proliferation marker protein Ki-67(MKI67),partial

ArtNr	CSB-EP014597HU(A5)-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Neural Development Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Bladder Cancer Breast Cancer Adhesion Molecule Markers
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	TKRHLRTRVQKVQVKEEPSAVKFTQTSGETTDADK EPAGEDKGIKALKESAKQTPAPAASVTGSRRRPRA PRESAQAIEDLAGFKDPAAGHTEESMTDDKTTKIP CKSSPELEDTATSSKRRPRTRAQKVEVKEELLAVG KLTQTSGETTHTDKEPVGEGKGTKAFKQPAKRKLD AEDVIGSRRQPRAPKEKAQPLEDLASFQELSQTPG HTEELANGAADSFTSAPKQTPDSGKPLKISRRVLR APK
Citations	"The cell proliferation-associated antigen of antibody Ki-67: a very large, ubiquitous nuclear protein with numerous repeated elements, representing a new kind of cell cycle-maintaining proteins."Schlueter C., Duchrow M., Wohlenberg C., Becker M.H.G., Key G., Flad H.-D., Gerdes J.J. Cell Biol. 123:513-522(1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	75.1 kDa
General Research Areas	Cancer
Relevance	Thought to be required for maintaining cell proliferation.
Expression Region	2720-3256aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly
Subcellular Location	Chromosome, Nucleus, Nucleus, nucleolus
Gene Names	MKI67
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern