« Back
Home /
Recombinant Human Proliferation marker protein Ki-67(MKI67),partial

Recombinant Human Proliferation marker protein Ki-67(MKI67),partial

Item no.	CSB-EP014597HU(A5)-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Oncology Neuroscience Neural Lineage Markers Neural Development Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Bladder Cancer Breast Cancer Adhesion Molecule Markers
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	TKRHLRTRVQKVQVKEEPSAVKFTQTSGETTDADK EPAGEDKGIKALKESAKQTPAPAASVTGSRRRPRA PRESAQAIEDLAGFKDPAAGHTEESMTDDKTTKIP CKSSPELEDTATSSKRRPRTRAQKVEVKEELLAVG KLTQTSGETTHTDKEPVGEGKGTKAFKQPAKRKLD AEDVIGSRRQPRAPKEKAQPLEDLASFQELSQTPG HTEELANGAADSFTSAPKQTPDSGKPLKISRRVLR APK
Citations	"The cell proliferation-associated antigen of antibody Ki-67: a very large, ubiquitous nuclear protein with numerous repeated elements, representing a new kind of cell cycle-maintaining proteins."Schlueter C., Duchrow M., Wohlenberg C., Becker M.H.G., Key G., Flad H.-D., Gerdes J.J. Cell Biol. 123:513-522(1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	75.1 kDa
General Research Areas	Cancer
Relevance	Thought to be required for maintaining cell proliferation.
Expression Region	2720-3256aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly
Subcellular Location	Chromosome, Nucleus, Nucleus, nucleolus
Gene Names	MKI67
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer