« Zurück
Startseite /
Recombinant Human 28S ribosomal protein S6, mitochondrial(MRPS6)

Recombinant Human 28S ribosomal protein S6, mitochondrial(MRPS6)

ArtNr	CSB-EP014937HU-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	PRYELALILKAMQRPETAATLKRTIEALMDRGAIV RDLENLGERALPYRISAHSQQHNRGGYFLVDFYAP TAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECE GIVPVPLAEKLYSTKKRKK
Protein Familie	Bacterial ribosomal protein bS6 family
Citations	"Nineteen additional unpredicted transcripts from human chromosome 21." Reymond A., Camargo A.A., Deutsch S., Stevenson B.J., Parmigiani R.B., Ucla C., Bettoni F., Rossier C., Lyle R., Guipponi M., de Souza S., Iseli C., Jongeneel C.V., Bucher P., Simpson A.J.G., Antonarakis S.E. Genomics 79:824-832(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	41.1 kDa
Expression Region	1-125aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Mitochondrion
Gene Names	MRPS6
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP014937HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 04.09.2025