« Zurück
Startseite /
Recombinant Human Major vault protein(MVP)

Recombinant Human Major vault protein(MVP)

ArtNr	CSB-EP015248HU-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYI RQDNERVLFAPMRMVTVPPRHYCTVANPVSRDAQG LVLFDVTGQVRLRHADLEIRLAQDPFPLYPGEVLE KDITPLQVVLPNTALHLKALLDFEDKDGDKVVAGD EWLFEGPGTYIPRKEVEVVEIIQATIIRQNQALRL RARKECWDRDGKERVTGEEWLVTTVGAYLPAVFEE VLDLVDAVILTEKTALHLRARRNFRDFRGVSRRTG EEW
Citations	An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Lung resistance-related protein
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	115.2 kDa
General Research Areas	Transport
Relevance	Required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-Cytoplasmic domain transport. Down-regulates INFG-mediated STAT1 signaling and subsequent activation of JAK. Down-regulates SRC activity and signaling through MAP kinases.
Expression Region	2-893aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. Down-regulates IFNG-mediated STAT1 signaling and subsequent activation of JAK. Down-regulates SRC activity and signaling through MAP kinases.
Subcellular Location	Cytoplasm, Nucleus, nuclear pore complex, Cytoplasm, perinuclear region
Tissue Specificity	Present in most normal tissues. Higher expression observed in epithelial cells with secretory and excretory functions, as well as in cells chronically exposed to xenobiotics, such as bronchial cells and cells lining the intestine. Overexpressed in many multidrug-resistant cancer cells.
Gene Names	MVP
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP015248HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern