« Zurück
Startseite /
Recombinant Human Neural cell adhesion molecule 1(NCAM1),partial

Recombinant Human Neural cell adhesion molecule 1(NCAM1),partial

ArtNr	CSB-EP015511HU1-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Kategorie	Oncology Neuroscience Neuroinflammation Molecular Targets for Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	ISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPN QQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTG EDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDA VIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLS NNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQ VIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGF PEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIK KVD
Citations	"Splicing of the VASE exon of neural cell adhesion molecule (NCAM) in human small-cell lung carcinoma (SCLC)." van Duijnhoven H.L., Helfrich W., de Leij L., Roebroek A.J., van de Ven W.J., Healey K., Culverwell A., Rossell R.J., Kemshead J.T., Patel K. Int. J. Cancer 50:118-123(1992)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD_antigen: CD56; NCAM
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	75.9 kDa
General Research Areas	Neuroscience
Relevance	This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc. (Microbial infection) Acts as a receptor for rabies virus.
Expression Region	31-677aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc.; FUNCTION
Subcellular Location	Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cell membrane, Lipid-anchor, GPI-anchor, SUBCELLULAR LOCATION: Isoform 4: Cell membrane, Lipid-anchor, GPI-anchor, SUBCELLULAR LOCATION: Isoform 5: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted
Biologically active	Not Test
Protein length	Partial of isform 2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP015511HU1-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern