« Zurück
Startseite /
Recombinant Dog Inactive pancreatic lipase-related protein 1(PNLIPRP1)

Recombinant Dog Inactive pancreatic lipase-related protein 1(PNLIPRP1)

ArtNr	CSB-EP018263DOa0-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	KEVCYEQIGCFSDAEPWAGTAIRPLKVLPWSPERI GTRFLLYTNKNPNNFQTLLPSDPSTIEASNFQTDK KTRFIIHGFIDKGEENWLLDMCKNMFKVEEVNCIC VDWKKGSQTSYTQAANNVRVVGAQVAQMLSMLSAN YSYSPSQVQLIGHSLGAHVAGEAGSRTPGLGRITG LDPVEASFQGTPEEVRLDPTDADFVDVIHTDAAPL IPFLGFGTSQQMGHLDFFPNGGEEMPGCKKNALSQ IVD
Protein Familie	AB hydrolase superfamily, Lipase family
Citations	"Structure of the canine pancreatic lipase gene."Mickel F.S., Weidenbach F., Swarovsky B., Laforge K.S., Scheele G.A.J. Biol. Chem. 264:12895-12901(1989)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Short name:PL-RP1
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	55.2 kDa
General Research Areas	Signal Transduction
Relevance	May function as inhibitor of dietary triglyceride digestion. Lacks detectable lipase activity towards triglycerides, diglycerides, phosphatidylcholine, galactolipids or cholesterol esters (in vitro).
Expression Region	18-467aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May function as inhibitor of dietary triglyceride digestion. Lacks detectable lipase activity towards triglycerides, diglycerides, phosphatidylcholine, galactolipids or cholesterol esters (in vitro).
Subcellular Location	Secreted
Tissue Specificity	Detected in pancreas (at protein level).
Gene Names	PNLIPRP1
Sequence Info	Full Length of Mature Protein
Organism	Canis lupus familiaris (Dog) (Canis familiaris)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP018263DOa0-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern