Comparison

Recombinant Human Paraneoplastic antigen Ma1(PNMA1)

Item no. CSB-EP018266HUb9-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Human (Homo sapiens)
Host E.coli
Conjugate/Tag Myc, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MAMTLLEDWCRGMDVNSQRALLVWGIPVNCDEAEI EETLQAAMPQVSYRMLGRMFWREENAKAALLELTG AVDYAAIPREMPGKGGVWKVLFKPPTSDAEFLERL HLFLAREGWTVQDVARVLGFQNPTPTPGPEMPAEM LNYILDNVIQPLVESIWYKRLTLFSGRDIPGPGEE TFDPWLEHTNEVLEEWQVSDVEKRRRLMESLRGPA ADVIRILKSNNPAITTAECLKALEQVFGSVESSRD AQI
Protein Family PNMA family
Citations Ma1, a novel neuron- and testis-specific protein, is recognized by the serum of patients with paraneoplastic neurological disorders.
Dalmau J., Gultekin S.H., Voltz R., Hoard R., DesChamps T., Balmaceda C., Batchelor T., Gerstner E., Eichen J., Frennier J., Posner J.B., Rosenfeld M.R.
Brain 122:27-39(1999)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 37KDA neuronal protein; Neuron- and testis-specific protein 1
Available
Manufacturer - Targets
PNMA1
Manufacturer - Conjugate / Tag
N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
46.8 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
Antibodies against PNMA1 are present in sera from patients suffering of paraneoplastic neurological disorders.
Biologically Active
Not Test
Expression Region
1-353aa
Protein Length
Full Length
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location
Nucleus, nucleolus
Tissue Specificity
Testis- and brain-specific. In some cancer patients, specifically expressed by paraneoplastic tumor cells.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Delivery expected until 10/2/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close