« Zurück
Startseite /
Recombinant Human Regenerating islet-derived protein 3-alpha(REG3A)

Recombinant Human Regenerating islet-derived protein 3-alpha(REG3A)

ArtNr	CSB-EP019548HU-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSW TDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIG NSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYF AWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVR LPYVCKFTD
Citations	Molecular basis for peptidoglycan recognition by a bactericidal lectin.Lehotzky R.E., Partch C.L., Mukherjee S., Cash H.L., Goldman W.E., Gardner K.H., Hooper L.V.Proc. Natl. Acad. Sci. U.S.A. 107:7722-7727(2010)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Hepatointestinal pancreatic protein ;HIP/PAPHuman proislet peptidePancreatitis-associated protein 1Regenerating islet-derived protein III-alpha ;Reg III-alpha
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	43.6 kDa
General Research Areas	Immunology
Relevance	Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
Expression Region	27-175aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
Subcellular Location	Secreted
Tissue Specificity	Highly expressed in epidermal keratinocytes of psoriasis patients (at protein level). Constitutively expressed in intestine. Low expression is found in healthy pancreas. Overexpressed during the acute phase of pancreatitis and in some patients with chronic pancreatitis.
Gene Names	REG3A
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP019548HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern