« Zurück
Startseite /
Recombinant Human Mitochondrial import receptor subunit TOM40 homolog(TOMM40)

Recombinant Human Mitochondrial import receptor subunit TOM40 homolog(TOMM40)

ArtNr	CSB-EP024050HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGF TLPPLGGSLGAGTSTSRSSERTPGAATASASGAAE DGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTV NKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQ LSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSK MAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDV LVGSGILVAHYLQSITPCLALGGELVYHRRPGEEG TVM
Protein Familie	Tom40 family
Citations	"Sequencing of 42kb of the APO E-C2 gene cluster reveals a new gene: PEREC1." Freitas E.M., Zhang W.J., Lalonde J.P., Tay G.K., Gaudieri S., Ashworth L.K., Van Bockxmeer F.M., Dawkins R.L. DNA Seq. 9:89-100(1998)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Protein Haymaker; Translocase of outer membrane 40KDA subunit homolog; p38.5
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	64.9 kDa
General Research Areas	Tags & Cell Markers
Relevance	Channel-forming protein essential for import of protein precursors into mitochondria.By similarity1 Publication
Expression Region	1-361aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Channel-forming protein essential for import of protein precursors into mitochondria.
Subcellular Location	Mitochondrion outer membrane, Multi-pass membrane protein
Gene Names	TOMM40
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP024050HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern