« Zurück
Startseite /
Recombinant Mouse Proto-oncogene Wnt-3(Wnt3)

Recombinant Mouse Proto-oncogene Wnt-3(Wnt3)

ArtNr	CSB-EP026135MO-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	GYPIWWSLALGQQYTSLASQPLLCGSIPGLVPKQL RFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNC TTIDDSLAIFGPVLDKATRESAFVHAIASAGVAFA VTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSED ADFGVLVSREFADARENRPDARSAMNKHNNEAGRT TILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIG DFLKDKYDSASEMVVEKHRESRGWVETLRAKYALF KPP
Protein Familie	Wnt family
Citations	Reciprocal regulation of Wnt and Gpr177/mouse Wntless is required for embryonic axis formation.Fu J., Jiang M., Mirando A.J., Yu H.-M., Hsu W.Proc. Natl. Acad. Sci. U.S.A. 106:18598-18603(2009)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Proto-oncogene Int-4
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	53.5 kDa
Relevance	Ligand for mbers of the frizzled family of seven transmbrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.
Expression Region	22-355aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.
Subcellular Location	Secreted, extracellular space, extracellular matrix
Tissue Specificity	Detected at low levels in adult brain (PubMed:2162045). Dorsal portion of the neural tube, dorsal ectoderm, the branchial arches, and the limb buds.
Gene Names	Wnt3
Sequence Info	Full Length of Mature Protein
Organism	Mus musculus (Mouse)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP026135MO-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern