« Zurück
Startseite /
Recombinant Chlamydia trachomatis 60KDA chaperonin(groL)

Recombinant Chlamydia trachomatis 60KDA chaperonin(groL)

ArtNr	CSB-EP314770DSB-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Neuroinflammation Neural Mitochondrial Function Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	VAKNIKYNEEARKKIQKGVKTLAEAVKVTLGPKGR HVVIDKSFGSPQVTKDGVTVAKEVELADKHENMGA QMVKEVASKTADKAGDGTTTATVLAEAIYTEGLRN VTAGANPMDLKRGIDKAVKVVVDQIRKISKPVQHH KEIAQVATISANNDAEIGNLIAEAMEKVGKNGSIT VEEAKGFETVLDIVEGMNFNRGYLSSYFATNPETQ ECVLEDALVLIYDKKISGIKDFLPVLQQVAESGRP LLI
Protein Familie	Chaperonin (HSP60) family
Citations	"Genome sequence of an obligate intracellular pathogen of humans: Chlamydia trachomatis."Stephens R.S., Kalman S., Lammel C.J., Fan J., Marathe R., Aravind L., Mitchell W.P., Olinger L., Tatusov R.L., Zhao Q., Koonin E.V., Davis R.W.Science 282:754-759(1998)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	57KDA chlamydial hypersensitivity antigen; GroEL protein; Heat shock protein 60; HSP60; Protein Cpn60
Lieferbar
Manufacturer - Targets	groL
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	74.0 kDa
General Research Areas	Microbiology
Relevance	Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions (By similarity). This protein is implicated in the pathogenesis of chlamydial disease. Inflammation elicited by the 57KDA antigen may damage tissue, with progression to scarring of conjunctival and fallopian tube mucosae, which respectively result in blindness and infertility.
Expression Region	2-544aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions (By similarity). This protein is implicated in the pathogenesis of chlamydial disease. Inflammation elicited by the 57 kDa antigen may damage tissue, with progression to scarring of conjunctival and fallopian tube mucosae, which respectively result in blindness and infertility.
Subcellular Location	Cytoplasm
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP314770DSB-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern