« Zurück
Startseite /
Recombinant Bacillus methanolicus NAD-dependent methanol dehydrogenase(mdh)

Recombinant Bacillus methanolicus NAD-dependent methanol dehydrogenase(mdh)

ArtNr	CSB-EP330043BAU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	Myc, SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	TNFFIPPASVIGRGAVKEVGTRLKQIGAKKALIVT DAFLHSTGLSEEVAKNIREAGLDVAIFPKAQPDPA DTQVHEGVDVFKQENCDALVSIGGGSSHDTAKAIG LVAANGGRINDYQGVNSVEKPVVPVVAITTTAGTG SETTSLAVITDSARKVKMPVIDEKITPTVAIVDPE LMVKKPAGLTIATGMDALSHAIEAYVAKGATPVTD AFAIQAMKLINEYLPKAVANGEDIEAREAMAYAQY MAG
Protein Familie	Iron-containing alcohol dehydrogenase family
Citations	"Electron microscopic analysis and biochemical characterization of a novel methanol dehydrogenase from the thermotolerant Bacillus sp. C1." Vonck J., Arfman N., de Vries G.E., van Beeumen J., van Bruggen E.F.J., Dijkhuizen L. J. Biol. Chem. 266:3949-3954(1991)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Type 3 alcohol dehydrogenase
Lieferbar
Manufacturer - Targets	mdh
Manufacturer - Conjugate / Tag	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	59.9 kDa
Relevance	Catalyzes the oxidation of methanol to yield formaldehyde. It possesses a NADH-dependent formaldehyde reductase activity and cannot use NADP.
Expression Region	2-381aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the oxidation of methanol to yield formaldehyde. It possesses a NADH-dependent formaldehyde reductase activity and cannot use NADP.
Subcellular Location	Cytoplasm
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP330043BAU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern