« Zurück
Startseite /
Recombinant Synechocystis sp.Ribonuclease J(rnj)

Recombinant Synechocystis sp.Ribonuclease J(rnj)

ArtNr	CSB-EP344938SSQ(A4)-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MAKNTQTQALKILPLGGLHEIGKNTCVFEYDDEIL LLDAGLAFPTDDMHGVNVVLPDMTYLRENREKIKG MVVTHGHEDHIGGIAYHLKQFDIPIIYGPRLAMAL LRDKLEEAGMLERTNLQTVSPREMVRLGKSFVVEF IRNTHSIADSYCLAIHTPLGVVMHSGDFKIDHTPI DGEFFDLQKVAEYGEKGVLCLLSDSTNAEVPGITP SEASVIPNLDRVFSQAEGRLMVTTFASSVHRVNII LSL
Protein Familie	Metallo-beta-lactamase superfamily, RNA-metabolizing metallo-beta-lactamase-like family, Bacterial RNase J subfamily
Citations	"A large-scale protein protein interaction analysis in Synechocystis sp. PCC6803." Sato S., Shimoda Y., Muraki A., Kohara M., Nakamura Y., Tabata S. DNA Res. 14:207-216(2007)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Targets	rnj
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	86.4 kDa
Relevance	An RNase that has 5'-3' exonuclease and possibly endoonuclease activity. Involved in maturation of rRNA and in some organisms also mRNA maturation and/or decay
Expression Region	1-640aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	An RNase that has 5'-3' exonuclease and possibly endoonuclease activity. Involved in maturation of rRNA and in some organisms also mRNA maturation and/or decay (By similarity).
Subcellular Location	Cytoplasm
Biologically active	Not Test
Protein length	Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern