« Zurück
Startseite /
Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial

Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial

ArtNr	CSB-EP345927HUV-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	KYEKPTNVWANAIGGTSLNNGGNASLYGTSAGVDA YLNGEVEAIVGGFGSYGYSSFNNQANSLNSGANNT NFGVYSRIFANQHEFDFEAQGALGSDQSSLNFKSA LLRDLNQSYNYLAYSAATRASYGYDFAFFRNALVL KPSVGVSYNHLGSTNFKSNSNQVALKNGSSSQHLF NASANVEARYYYGDTSYFYMNAGVLQEFANFGSSN AVSLNTFKVNAAHNPLSTHARVMMGGELKLAKEVF LNL
Citations	The complete genome sequence of the gastric pathogen Helicobacter pylori.Tomb J.-F., White O., Kerlavage A.R., Clayton R.A., Sutton G.G., Fleischmann R.D., Ketchum K.A., Klenk H.-P., Gill S.R., Dougherty B.A., Nelson K.E., Quackenbush J., Zhou L., Kirkness E.F., Peterson S.N., Loftus B.J., Richardson D.L., Dodson R.J. , Khalak H.G., Glodek A., McKenney K., FitzGerald L.M., Lee N., Adams M.D., Hickey E.K., Berg D.E., Gocayne J.D., Utterback T.R., Peterson J.D., Kelley J.M., Cotton M.D., Weidman J.F., Fujii C., Bowman C., Watthey L., Wallin E., Hayes W.S., Borodovsky M., Karp P.D., Smith H.O., Fraser C.M., Venter J.C.Nature 388:539-547(1997)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-B2M-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	43.6 kDa
Relevance	Induces vacuolation of eukaryotic cells. Causes ulceration and gastric lesions.
Expression Region	1018-1290aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Induces vacuolation of eukaryotic cells. Causes ulceration and gastric lesions.
Subcellular Location	Vacuolating cytotoxin autotransporter: Periplasm, SUBCELLULAR LOCATION: Vacuolating cytotoxin: Secreted, Cell surface, SUBCELLULAR LOCATION: Vacuolating cytotoxin translocator: Cell outer membrane, Multi-pass membrane protein
Gene Names	vacA
Sequence Info	Partial
Organism	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP345927HUV-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern