« Zurück
Startseite /
Recombinant Moloney murine leukemia virus Gag polyprotein(gag),partial

Recombinant Moloney murine leukemia virus Gag polyprotein(gag),partial

ArtNr	CSB-EP356017MHKe0-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Mouse (Murine, Mus musculus)
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	PLRAGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPG KLTALIESVLITHQPTWDDCQQLLGTLLTGEEKQR VLLEARKAVRGDDGRPTQLPNEVDAAFPLERPDWD YTTQAGRNHLVHYRQLLLAGLQNAGRSPTNLAKVK GITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQE TNVSMSFIWQSAPDIGRKLERLEDLKNKTLGDLVR EAEKIFNKRETPEEREERIRRETEEKEERRRTEDE QKE
Citations	Late domain-independent rescue of a release-deficient Moloney murine leukemia virus by the ubiquitin ligase Itch.Jadwin J.A., Rudd V., Sette P., Challa S., Bouamr F.J. Virol. 84:704-715(2010)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Core polyprotein
Lieferbar
Manufacturer - Targets	gag
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	57.6 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Microbiology
Relevance	Gag polyprotein plays a role in budding and is processed by the viral protease during virion maturation outside the cell. During budding, it recruits, in a PPXY-dependent or independent manner, Nedd4-like ubiquitin ligases that conjugate ubiquitin molecules to Gag, or to Gag binding host factors. Interaction with HECT ubiquitin ligases probably link the viral protein to the host ESCRT pathway and facilitate release.
Biologically Active	Not Test
Expression Region	216-478aa
Protein Length	Partial
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Gag polyprotein
Subcellular Location	Gag polyprotein: Virion, Host cell membrane, Lipid-anchor, Host late endosome membrane, Lipid-anchor, Host endosome, host multivesicular body, Note=These locations are probably linked to virus assembly sites, SUBCELLULAR LOCATION: Matrix protein p15: Virion, SUBCELLULAR LOCATION: Capsid protein p30: Virion, SUBCELLULAR LOCATION: Nucleocapsid protein p10-Gag: Virion, SUBCELLULAR LOCATION: RNA-binding phosphoprotein p12: Host cytoplasm

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP356017MHKe0-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern