« Zurück
Startseite /
Recombinant Escherichia coli O6:H1 Exopolyphosphatase(ppx)

Recombinant Escherichia coli O6:H1 Exopolyphosphatase(ppx)

ArtNr	CSB-EP360285EGX-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	PIHDKSPRPQEFAAVDLGSNSFHMVIARVVDGAMQ IIGRLKQRVHLADGLGPDNMLSEEAMTRGLNCLSL FAERLQGFSPASVCIVGTHTLRQALNATDFLKRAE KVIPYPIEIISGNEEARLIFMGVEHTQPEKGRKLV IDIGGGSTELVIGENFEPILVESRRMGCVSFAQLY FPGGVINKENFQRARMAAAQKLETLTWQFRIQGWN VAMGASGTIKAAHEVLMEMGEKDGIITPERLEKLV KEV
Protein Familie	GppA/Ppx family
Citations	"Extensive mosaic structure revealed by the complete genome sequence of uropathogenic Escherichia coli."Welch R.A., Burland V., Plunkett G. III, Redford P., Roesch P., Rasko D., Buckles E.L., Liou S.-R., Boutin A., Hackett J., Stroud D., Mayhew G.F., Rose D.J., Zhou S., Schwartz D.C., Perna N.T., Mobley H.L.T., Donnenberg M.S., Blattner F.R.Proc. Natl. Acad. Sci. U.S.A. 99:17020-17024(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Metaphosphatase
Lieferbar
Manufacturer - Targets	ppx
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	62.0 kDa
General Research Areas	Microbiology
Relevance	Degradation of inorganic polyphosphates. Orthophosphate is released progressively from the ends of polyphosphate of circa 500 residues long, while chains of circa 15 residues compete poorly with polyphosphate as substrate
Expression Region	2-513aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Degradation of inorganic polyphosphates (polyP). Releases orthophosphate processively from the ends of the polyP chain.
Subcellular Location	Cell membrane, Peripheral membrane protein
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP360285EGX-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern