« Zurück
Startseite /
Recombinant Anas platyrhynchos Lysozyme C-1

Recombinant Anas platyrhynchos Lysozyme C-1

ArtNr	CSB-EP360572BED-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	KVYSRCELAAAMKRLGLDNYRGYSLGNWVCAANYE SGFNTQATNRNTDGSTDYGILQINSRWWCDNGKTP RSKNACGIPCSVLLRSDITEAVRCAKRIVSDGDGM NAWVAWRNRCRGTDVSKWIRGCRL
Protein Familie	Glycosyl hydrolase 22 family
Citations	"Chemical and immunological properties and amino acid sequences of three lysozymes from Peking-duck egg white."Kondo K., Fujio H., Amano T. J. Biochem. 91:571-587(1982)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	1,4-beta-N-acetylmuramidase C
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	30.5 kDa
Relevance	Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.
Expression Region	19-147aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.
Subcellular Location	Secreted
Sequence Info	Full Length of Mature Protein
Organism	Anas platyrhynchos (Mallard) (Anas boschas)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP360572BED-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern