Vergleich

Recombinant BK polyomavirus Minor capsid protein VP2

ArtNr CSB-EP360956BGYb0-500
Hersteller Cusabio
Menge 500 ug
Quantity options 1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Konjugat/Tag HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence GAALALLGDLVASVSEAAAATGFSVAEIAAGEAAA AIEVQIASLATVEGITSTSEAIAAIGLTPQTYAVI AGAPGAIAGFAALIQTVSGISSLAQVGYRFFSDWD HKVSTVGLYQQSGMALELFNPDEYYDILFPGVNTF VNNIQYLDPRHWGPSLFATISQALWHVIRDDIPSI TSQELQRRTERFFRDSLARFLEETTWTIVNAPINF YNYIQQYYSDLSPIRPSMVRQVAEREGTRVHFGHT YSI
Protein Familie Polyomaviruses capsid protein VP2 family
Citations The Polyomaviridae Contributions of virus structure to our understanding of virus receptors and infectious entry.Neu U., Stehle T., Atwood W.J.Virology 384:389-399(2009)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
41.7 kDa
Relevance
Isoform VP2 is a structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Participates in host cell receptor binding together with VP1. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum mbrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum mbrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Plays a role in virion assbly within the nucleus in particular through a DNA-binding domain located in the C-terminal region. A N-terminal myristoylation suggests a scaffold function for virion assbly .Isoform VP3: structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum mbrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum mbrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Isoform VP3 plays a role in virion assbly within the nucleus. May participate in host cell lysis when associated with VP4 .Isoform VP4 is a viroporin inducing perforation of cellular mbranes to trigger virus progeny release. Forms pores of 3 nm inner diameter. VP4 is expressed about 24 hours after the late structural proteins and is not incorporated into the mature virion .
Expression Region
2-351aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Isoform VP2 is a structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Participates in host cell receptor binding together with VP1. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Plays a role in virion assembly within the nucleus in particular through a DNA-binding domain located in the C-terminal region. A N-terminal myristoylation suggests a scaffold function for virion assembly (By similarity).
Subcellular Location
Isoform VP2: Virion, Host nucleus, Host endoplasmic reticulum, Host endoplasmic reticulum membrane, SUBCELLULAR LOCATION: Isoform VP3: Virion, Host nucleus, Host endoplasmic reticulum, Host endoplasmic reticulum membrane, SUBCELLULAR LOCATION: Isoform VP4: Host nucleus
Biologically active
Not Test
Protein length
Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 28.08.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen