« Zurück
Startseite /
Recombinant Oryza sativa subsp. japonica Mitogen-activated protein kinase 5(MPK5)

Recombinant Oryza sativa subsp. japonica Mitogen-activated protein kinase 5(MPK5)

ArtNr	CSB-EP607476OFG-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MDGAPVAEFRPTMTHGGRYLLYDIFGNKFEVTNKY QPPIMPIGRGAYGIVCSVMNFETREMVAIKKIANA FNNDMDAKRTLREIKLLRHLDHENIIGIRDVIPPP IPQAFNDVYIATELMDTDLHHIIRSNQELSEEHCQ YFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCD LKICDFGLARPSSESDMMTEYVVTRWYRAPELLLN STDYSAAIDVWSVGCIFMELINRQPLFPGRDHMHQ MRL
Protein Familie	Protein kinase superfamily, CMGC Ser/Thr protein kinase family, MAP kinase subfamily
Citations	"Isolation of novel rice (Oryza sativa L.) multiple stress responsive MAP kinase gene, OsMSRMK2, whose mRNA accumulates rapidly in response to environmental cues." Agrawal G.K., Rakwal R., Iwahashi H. Biochem. Biophys. Res. Commun. 294:1009-1016(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Benzothiadiazole-induced MAP kinase 1; MAP kinase 2; Multiple stress-responsive MAP kinase 2; OsBIMK1; OsMAP1; OsMAPK2; OsMAPK5; OsMPK3; OsMSRMK2; BIMK1, MAPK2, MAPK5, MPK3, MSRMK2
Lieferbar
Manufacturer - Targets	MPK5
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	48.0 kDa
Relevance	Involved in disease resistance and abiotic stress tolerance signaling pathways. Acts as a positive regulator of drought, salt and cold tolerance. Negatively modulates pathogenesis-related (PR) gene expression and broad-spectrum disease resistance. Functions downstream of CPK18 in a signaling pathway that represses defense gene expression and negatively regulates resistance to rice blast fungus. Phosphorylated by CPK18 at Thr-14 and Thr-32 and activated independently of MAP kinase kinase (MKK) phosphorylation
Expression Region	1-369aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in disease resistance and abiotic stress tolerance signaling pathways. Acts as a positive regulator of drought, salt and cold tolerance. Negatively modulates pathogenesis-related (PR) gene expression and broad-spectrum disease resistance
Subcellular Location	Nucleus, Cytoplasm
Tissue Specificity	Expressed in roots, stems and panicles, and at lower levels in leaves.
Biologically active	Not Test
Protein length	Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP607476OFG-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern