Vergleich

Recombinant Human Protein unc-119 homolog A(UNC119)

ArtNr CSB-EP622658HU-100
Hersteller Cusabio
Menge 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Konjugat/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAES ESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQR ITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEI KKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRL RQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSF DFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRH PYETQSDSFYFVDDRLVMHNKADYSYSGTP
Protein Familie PDE6D/unc-119 family
Citations Cloning of the cDNA for a novel photoreceptor protein.Higashide T., Murakami A., McLaren M.J., Inana G.J. Biol. Chem. 271:1797-1804(1996)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Retinal protein 4; Short name:; hRG4
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
43 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Neuroscience
Relevance
Involved in synaptic functions in photoreceptor cells, the signal transduction in immune cells as a Src family kinase activator, endosome recycling, the uptake of bacteria and endocytosis, protein trafficking in sensory neurons and as lipid-binding chaperone with specificity for a diverse subset of myristoylated proteins. Specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Binds myristoylated GNAT1 and is required for G-protein localization and trafficking in sensory neurons. Probably plays a role in trafficking proteins in photoreceptor cells. Plays important roles in mediating Src family kinase signals for the completion of cytokinesis via RAB11A.
Expression Region
1-240aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Involved in synaptic functions in photoreceptor cells, the signal transduction in immune cells as a Src family kinase activator, endosome recycling, the uptake of bacteria and endocytosis, protein trafficking in sensory neurons and as lipid-binding chaperone with specificity for a diverse subset of myristoylated proteins. Specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Binds myristoylated GNAT1 and is required for G-protein localization and trafficking in sensory neurons. Probably plays a role in trafficking proteins in photoreceptor cells. Plays important roles in mediating Src family kinase signals for the completion of cytokinesis via RAB11A.
Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Cytoplasm, cytoskeleton, spindle pole, Cytoplasm, cytoskeleton, spindle
Tissue Specificity
Abundantly expressed in retina, in photoreceptor synapses and inner segments. Expressed in a much lesser extent in several other tissues.
Involvement in disease
Immunodeficiency 13 (IMD13)
Gene Names
UNC119
Sequence Info
Full Length
Organism
Homo sapiens (Human)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen