« Zurück
Startseite /
Recombinant Bovine Pregnancy-associated glycoprotein 1

Recombinant Bovine Pregnancy-associated glycoprotein 1

ArtNr	CSB-EP644917BO-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	RGSNLTTHPLRNIKDLVYMGNITIGTPPQEFQVVF DTASSDLWVPSDFCTSPACSTHVRFRHLQSSTFRL TNKTFRITYGSGRMKGVVVHDTVRIGNLVSTDQPF GLSIEEYGFEGRIYDGVLGLNYPNISFSGAIPIFD KLKNQRAISEPVFAFYLSKDEREGSVVMFGGVDHR YYEGELNWVPLIQAGDWSVHMDRISIERKIIACSD GCKALVDTGTSDIVGPRRLVNNIHRLIGAIPRGSE HYV
Protein Familie	Peptidase A1 family
Citations	"The gene encoding bovine pregnancy-associated glycoprotein-1, an inactive member of the aspartic proteinase family." Xie S., Green J., Beckers J.-F.M.P., Roberts R.M. Gene 159:193-197(1995)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Pregnancy-specific protein B; Short name:; PSP-B
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	40.7 kDa
Relevance	Appears to be proteolytically inactive.
Expression Region	54-380aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Appears to be proteolytically inactive.
Subcellular Location	Secreted, extracellular space
Tissue Specificity	Trophoblast and placental tissue. Produced specifically in the invasive binucleate cells of the placenta. Becomes detectable in maternal serum soon after implantation.
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP644917BO-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern