« Zurück
Startseite /
Recombinant Mouse Transcription factor MafK(Mafk)

Recombinant Mouse Transcription factor MafK(Mafk)

ArtNr	CSB-EP713990MOb1-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins Neuronal Cell Markers
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVR ELNQHLRGLTKEEVTRLKQRRRTLKNRGYAASCRI KRVTQKEELERQRVELQQEVEKLARENSSMRLELD ALRSKYEALQTFARTVARGPVTPTKVATTSVITIV KSAELSSTSVPFSAAS
Protein Familie	BZIP family, Maf subfamily
Citations	The ubiquitous subunit of erythroid transcription factor NF-E2 is a small basic-leucine zipper protein related to the v-maf oncogene. Andrews N.C., Kotkow K.J., Ney P.A., Erdjument-Bromage H., Tempst P., Orkin S.H. Proc. Natl. Acad. Sci. U.S.A. 90:11488-11492(1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Erythroid transcription factor NF-E2 p18 subunit
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	22.5 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor.
Expression Region	1-156aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins, such as NFE2, NFE2L1/NRF1, NFE2L2/NRF2 and NFE2L3/NRF3, and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor.
Subcellular Location	Nucleus
Tissue Specificity	Highly expressed in heart, skeletal muscle and placenta. Also expressed in erythroid cells.
Gene Names	Mafk
Sequence Info	Full Length
Organism	Mus musculus (Mouse)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP713990MOb1-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern