« Zurück
Startseite /
Recombinant Human Astacin-like metalloendopeptidase(ASTL)

Recombinant Human Astacin-like metalloendopeptidase(ASTL)

ArtNr	CSB-EP760708HU-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	APLASSCAGACGTSFPDGLTPEGTQASGDKDIPAI NQGLILEETPESSFLIEGDIIRPSPFRLLSATSNK WPMGGSGVVEVPFLLSSKYDEPSRQVILEALAEFE RSTCIRFVTYQDQRDFISIIPMYGCFSSVGRSGGM QVVSLAPTCLQKGRGIVLHELMHVLGFWHEHTRAD RDRYIRVNWNEILPGFEINFIKSQSSNMLTPYDYS SVMHYGRLAFSRRGLPTITPLWAPSVHIGQRWNLS ASD
Protein Familie	Peptidase M12A family
Citations	"Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study." Bailey S.D., Xie C., Do R., Montpetit A., Diaz R., Mohan V., Keavney B., Yusuf S., Gerstein H.C., Engert J.C., Anand S. Diabetes Care 33:2250-2253(2010)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Oocyte astacin (Ovastacin)
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	50.6 kDa
General Research Areas	Signal Transduction
Relevance	Oocyte-specific oolemmal receptor involved in sperm and egg adhesion and fertilization. Plays a role in the polyspermy inhibition. Probably acts as a protease for the post-fertilization cleavage of ZP2. Cleaves the sperm-binding ZP2 at the surface of the zona pellucida after fertilization and cortical granule exocytosis, rendering the zona pellucida unable to support further sperm binding
Expression Region	24-431aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Oocyte-specific oolemmal receptor involved in sperm and egg adhesion and fertilization. Plays a role in the polyspermy inhibition. Probably acts as a protease for the post-fertilization cleavage of ZP2. Cleaves the sperm-binding ZP2 at the surface of the zona pellucida after fertilization and cortical granule exocytosis, rendering the zona pellucida unable to support further sperm binding (By similarity).
Subcellular Location	Cytoplasm, Cell membrane, Cytoplasmic granule, Cytoplasmic vesicle, secretory vesicle
Tissue Specificity	Expressed in promyelocytic leukemia HL-60 cells, Burkitt's lymphoma Raji cells, and also in some ovarian carcinomas. Not detected in normal tissues.
Gene Names	ASTL
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP760708HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 04.09.2025