Vergleich

Recombinant Mouse RNA binding protein fox-1 homolog 3 (Rbfox3)

ArtNr CSB-EP806847MO-100
Hersteller Cusabio
Menge 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Konjugat/Tag Myc, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSG QTPVPPEHGMTLYTPAQTHPEQPGTEASTQPIAGT QTVPQADEAAQTDNQQLHPSDPTEKQQPKRLHVSN IPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGF GFVTFETSSDADRAREKLNGTIVEGRKIEVNNATA RVMTNKKPGNPYANGWKLNPVVGTVYGPEFYAVTS FPYPTTGTAVAYRGAHLRGRGRAVYNTFRAAPPPP PIP
Citations NeuN/Rbfox3 nuclear and cytoplasmic isoforms differentially regulate alternative splicing and nonsense-mediated decay of Rbfox2.
Dredge B.K., Jensen K.B.
PLoS ONE 6:E21585-E21585(2011)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Fox-1 homolog C (Hexaribonucleotide-binding protein 3) (Fox-3) (Neuronal nuclei antigen) (NeuN antigen) (D11Bwg0517e) (Hrnbp3)
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
47.6 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
Pre-mRNA alternative splicing regulator. Regulates alternative splicing of RBFOX2 to enhance the production of mRNA species that are targeted for nonsense-mediated decay (NMD)
Expression Region
1-374aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Pre-mRNA alternative splicing regulator. Regulates alternative splicing of RBFOX2 to enhance the production of mRNA species that are targeted for nonsense-mediated decay (NMD).
Subcellular Location
Nucleus, Cytoplasm, SUBCELLULAR LOCATION: Isoform 1: Nucleus, SUBCELLULAR LOCATION: Isoform 4: Cytoplasm, SUBCELLULAR LOCATION: Isoform 5: Nucleus
Tissue Specificity
Widely expressed in brain, including in cerebral cortex, hippocampus, thalamus, caudate/putamen, cerebellum, as well as in the spinal cord (at protein level). Not expressed in all neuronal cells within a region, in cerebellum, expression is absent in Purkinje cells (at protein level). Expressed in the retina in the ganglion cells and some cells in the inner nuclear layer, but absent from the photoreceptor cells and most cells in the inner nuclear layer (at protein level).
Gene Names
Rbfox3
Sequence Info
Full Length
Organism
Mus musculus (Mouse)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 28.08.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen