« Zurück
Startseite /
Recombinant Human RNA-binding protein with multiple splicing(RBPMS)

Recombinant Human RNA-binding protein with multiple splicing(RBPMS)

ArtNr	CSB-EP821892HU-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MNNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDI KPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDS RSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKM AKNKLVGTPNPSTPLPNTVPQFIAREPYELTVPAL YPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHA QMRWLPPSEATSQGWKSRQFC
Citations	"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB." Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R. Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Heart and RRM expressed sequence (Hermes) (RBP-MS) (HERMES)
Lieferbar
Manufacturer - Targets	RBPMS
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	28.8 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Acts as a coactivator of transcriptional activity. Required to increase TGFB1/Smad-mediated transactivation. Acts through SMAD2, SMAD3 and SMAD4 to increase transcriptional activity. Increases phosphorylation of SMAD2 and SMAD3 on their C-terminal SSXS motif, possibly through recruitment of TGFBR1. Promotes the nuclear accumulation of SMAD2, SMAD3 and SMAD4 proteins. Binds to poly RNA .
Expression Region	1-196aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a coactivator of transcriptional activity. Required to increase TGFB1/Smad-mediated transactivation. Acts through SMAD2, SMAD3 and SMAD4 to increase transcriptional activity. Increases phosphorylation of SMAD2 and SMAD3 on their C-terminal SSXS motif, possibly through recruitment of TGFBR1. Promotes the nuclear accumulation of SMAD2, SMAD3 and SMAD4 proteins
Subcellular Location	Nucleus, Cytoplasm, Cytoplasm, P-body
Tissue Specificity	Ubiquitously expressed, at various levels depending on the isoform and the tissue.
Biologically active	Not Test
Protein length	Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP821892HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern