« Zurück
Startseite /
Recombinant Human Selenoprotein M(SELM)

Recombinant Human Selenoprotein M(SELM)

ArtNr	CSB-EP837868HUe1-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKA FVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELE RIPLSEMTREEINALVQELGFYRKAAPDAQVPPEY VWAPAKPPEETSDHADL
Protein Familie	Selenoprotein M/F family
Citations	"Mammalian selenoprotein in which selenocysteine (Sec) incorporation is supported by a new form of Sec insertion sequence element." Korotkov K.V., Novoselov S.V., Hatfield D.L., Gladyshev V.N. Mol. Cell. Biol. 22:1402-1411(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Targets	SELM
Manufacturer - Conjugate / Tag	Tag-Free
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	13.9 kDa
Relevance	May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation.
Expression Region	24-145aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation.
Subcellular Location	Cytoplasm, perinuclear region, Endoplasmic reticulum, Golgi apparatus
Tissue Specificity	Widely expressed.
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP837868HUe1-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern