« Zurück
Startseite /
Recombinant Reston ebolavirus Nucleoprotein(NP),partial

Recombinant Reston ebolavirus Nucleoprotein(NP),partial

ArtNr	CSB-EP841983RCI-100
Hersteller	Cusabio
Menge	100 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	RPNLGSRQDDDNEIPFPGPISNNPDQDHLEDDPRD SRDTIIPNSAIDPEDGDFENYNGYHDDEVGTAGDL VLFDLDDHEDDNKAFELQDSSPQSQREIERERLIH PPPGNNKDDNRASDNNQQSADSEEQEGQYNRHRGP ERTTANRRLSPVHEEDTPIDQGDDDPSSPPPLESD DDDASSSQQDPDYTAVAPPAPVYRSAEAHEPPHKS SNEPAETSQLNEDPDIGQSKSMQKLGETYHHLLRT QGP
Protein Familie	Filoviruses nucleoprotein family
Citations	Genome structure of Ebola virus subtype Reston: differences among Ebola subtypes. Ikegami T., Calaor A.B., Miranda M.E., Niikura M., Saijo M., Kurane I., Yoshikawa Y., Morikawa S. Arch. Virol. 146:2021-2027(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Nucleocapsid protein
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	41.3 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Microbiology
Relevance	Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid and serves as template for transcription and replication. During replication, encapsidation by NP is coupled to RNA synthesis and all replicative products are resistant to nucleases
Expression Region	414-739aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid and serves as template for transcription and replication. During replication, encapsidation by NP is coupled to RNA synthesis and all replicative products are resistant to nucleases (By similarity).
Subcellular Location	Virion, Host cytoplasm
Gene Names	NP
Sequence Info	Partial
Organism	Reston ebolavirus (strain Philippines-96) (REBOV) (Reston Ebola virus)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP841983RCI-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 04.09.2025