« Zurück
Startseite /
Recombinant Human E3 ubiquitin-protein ligase pellino homolog 1(PELI1)

Recombinant Human E3 ubiquitin-protein ligase pellino homolog 1(PELI1)

ArtNr	CSB-EP856932HUe0-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRG RRKSRFALFKRPKANGVKPSTVHIACTPQAAKAIS NKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRS TESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACR IICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKT SDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREIS VCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLID LCG
Protein Familie	Pellino family
Citations	"Assignment of homologous genes, Peli1/PELI1 and Peli2/PELI2, for the Pelle adaptor protein Pellino to mouse chromosomes 11 and 14 and human chromosomes 2p13.3 and 14q21, respectively, by physical and radiation hybrid mapping." Resch K., Jockusch H., Schmitt-John T. Cytogenet. Cell Genet. 92:172-174(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Pellino-related intracellular-signaling molecule (RING-type E3 ubiquitin transferase pellino homolog 1) (Pellino-1) (PRISM)
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	73.0 kDa
General Research Areas	Signal Transduction
Relevance	E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation.
Expression Region	1-418aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation.
Gene Names	PELI1
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP856932HUe0-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern