« Zurück
Startseite /
Recombinant Human Dynein light chain roadblock-type 1(DYNLRB1),partial

Recombinant Human Dynein light chain roadblock-type 1(DYNLRB1),partial

ArtNr	CSB-EP865093HU-100
Hersteller	Cusabio
Menge	100 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Hepatic Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNP TTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIR SKKNEIMVAPDKDYFLIVIQNPTE
Protein Familie	GAMAD family
Citations	Identification of two novel human dynein light chain genes, DNLC2A and DNLC2B, and their expression changes in hepatocellular carcinoma tissues from 68 Chinese patients.Jiang J., Yu L., Huang X., Chen X., Li D., Zhang Y., Tang L., Zhao S.Gene 281:103-113(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Bithoraxoid-like protein ;BLPDynein light chain 2A, Cytoplasmic domainDynein-associated protein Km23Roadblock domain-containing protein 1
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	26.7 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Cancer
Relevance	Acts as one of several non-catalytic accessory components of the Cytoplasmic domain dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic domain dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.
Expression Region	3-96aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.
Subcellular Location	Cytoplasm, cytoskeleton
Tissue Specificity	High expression in heart, liver, brain and pancreas; moderate in placenta, skeletal muscle and kidney; low in lung, prostate, testis, small intestine and colon. Isoform 1 expression is up-regulated in 64% hepatocellular carcinoma (HCC) patients.
Gene Names	DYNLRB1
Sequence Info	Partial
Organism	Homo sapiens (Human)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP865093HU-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern