« Zurück
Startseite /
Recombinant Arabidopsis thaliana UDP-glycosyltransferase 78D1(UGT78D1)

Recombinant Arabidopsis thaliana UDP-glycosyltransferase 78D1(UGT78D1)

ArtNr	CSB-EP871008DOA-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MTKFSEPIRDSHVAVLAFFPVGAHAGPLLAVTRRL AAASPSTIFSFFNTARSNASLFSSDHPENIKVHDV SDGVPEGTMLGNPLEMVELFLEAAPRIFRSEIAAA EIEVGKKVTCMLTDAFFWFAADIAAELNATWVAFW AGGANSLCAHLYTDLIRETIGLKDVSMEETLGFIP GMENYRVKDIPEEVVFEDLDSVFPKALYQMSLALP RASAVFISSFEELEPTLNYNLRSKLKRFLNIAPLT LLS
Protein Familie	UDP-glycosyltransferase family
Citations	"Phylogenetic analysis of the UDP-glycosyltransferase multigene family of Arabidopsis thaliana." Li Y., Baldauf S., Lim E.K., Bowles D.J. J. Biol. Chem. 276:4338-4343(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Flavonol-3-O-glucoside L-rhamnosyltransferase; UDP-rhamnose:flavonol 3-O-glucoside rhamnosyltransferase
Lieferbar
Manufacturer - Targets	UGT78D1
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	55.6 kDa
Relevance	Acts as a UDP-rhamnose:flavonol-3-O-glucoside rhamnosyltransferase. Keampferol and quercitin are used as substrates. Possesses low quercetin 3-O-glucosyltransferase activity in vitro.
Expression Region	1-453aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a UDP-rhamnose
Tissue Specificity	Expressed in leaves, flowers, siliques, and stems.
Biologically active	Not Test
Protein length	Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP871008DOA-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 04.09.2025