« Zurück
Startseite /
Recombinant Human mRNA-decapping enzyme 1A(DCP1A)

Recombinant Human mRNA-decapping enzyme 1A(DCP1A)

ArtNr	CSB-EP885684HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MEALSRAGQEMSLAALKQHDPYITSIADLTGQVAL YTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIV NRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIY SIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDK QSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGD SNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSA PSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERL PGD
Protein Familie	DCP1 family
Citations	"Identification of a human decapping complex associated with hUpf proteins in nonsense-mediated decay."Lykke-Andersen J.Mol. Cell. Biol. 22:8114-8121(2002).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Smad4-interacting transcriptional co-activator; Transcription factor SMIF
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	67.3 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Contributes to the transactivation of target genes after stimulation by TGFB1.
Expression Region	1-582aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Contributes to the transactivation of target genes after stimulation by TGFB1.
Subcellular Location	Cytoplasm, P-body, Nucleus
Tissue Specificity	Detected in heart, brain, placenta, lung, skeletal muscle, liver, kidney and pancreas.
Gene Names	DCP1A
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP885684HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern