« Zurück
Startseite /
Recombinant Human Coiled-coil domain-containing protein 41(CCDC41)

Recombinant Human Coiled-coil domain-containing protein 41(CCDC41)

ArtNr	CSB-EP896730HU-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MLIDERLRCEHHKANYQTLKAEHTRLQNEHVKLQN ELKHLFNEKQTQQEKLQLLLEELRGELVEKTKDLE EMKLQILTPQKLELLRAQIQQELETPMRERFRNLD EEVEKYRAVYNKLRYEHTFLKSEFEHQKEEYARIL DEGKIKYESEIARLEEDKEELRNQLLNVDLTKDSK RVEQLAREKVYLCQKLKGLEAEVAELKAEKENSEA QVENAQRIQVRQLAEMQATVRSLEAEKQSANLRAE RLE
Protein Familie	CEP83 family
Citations	Antigens recognized by autologous antibody in patients with renal-cell carcinoma.Scanlan M.J., Gordan J.D., Williamson B., Stockert E., Bander N.H., Jongeneel C.V., Gure A.O., Jaeger D., Jaeger E., Knuth A., Chen Y.-T., Old L.J.3.0.CO;2-5>Int. J. Cancer 83:456-464(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Coiled-coil domain-containing protein 41Renal carcinoma antigen NY-REN-58
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	83.4 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Cell Biology
Relevance	Component of the distal appendage region of the centriole involved in the initiation of primary cilium assbly. May collaborate with IFT20 in the trafficking of ciliary mbrane proteins from the Golgi complex to the cilium during the initiation of primary cilium assbly.
Expression Region	1-568aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Component of the distal appendage region of the centriole involved in the initiation of primary cilium assembly. May collaborate with IFT20 in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium during the initiation of primary cilium assembly.
Subcellular Location	Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole
Involvement in disease	Nephronophthisis 18 (NPHP18)
Gene Names	CCDC41
Sequence Info	Full Length of Isoform 2
Organism	Homo sapiens (Human)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP896730HU-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern