« Zurück
Startseite /
Recombinant Dog Annexin A13(ANXA13)

Recombinant Dog Annexin A13(ANXA13)

ArtNr	CSB-MP001839DO-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug 500 ug
Kategorie	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Mammalian cells
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	GNRHAKAKSHHGFDVDHDAKKLNKACKGMGTDEAA IIEILSSRTSDERQQIKQKYKATYGKDLEEVFKSD LSGNFEKTALALLDRPSEYDARQLQKAMKGLGTDE AVLIEILCTRTNKEIMAIKEAYQRLFDRSLESDVK ADTSGNLKAILVSLLQANRDEGDDVDKDLAGQDAK DLYDAGDGRWGTDELAFNEVLAKRSHKQLRATFQA YQILIDKDIEEAIEAETSGDLQKAYLTLVRCARDQ EGY
Protein Familie	Annexin family
Citations	"Annexin XIIIb: a novel epithelial specific annexin is implicated in vesicular traffic to the apical plasma membrane."Fiedler K., Lafont F., Parton R.G., Simons K.J. Cell Biol. 128:1043-1053(1995).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Annexin XIII; Annexin-13; Intestine-specific annexin; Short name:; ISA
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	39.3 kDa
General Research Areas	Signal Transduction
Relevance	Involved in vesicular traffic to the apical plasma membrane (isoform B).
Expression Region	2-316aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in vesicular traffic to the apical plasma membrane (isoform B).
Subcellular Location	Isoform B: Cytoplasmic vesicle
Tissue Specificity	Epithelia (isoform A); intestine and kidney (isoform B).
Gene Names	ANXA13
Sequence Info	Full Length of Mature Protein
Organism	Canis lupus familiaris (Dog) (Canis familiaris)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP001839DO-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern