« Zurück
Startseite /
Recombinant Mouse Clathrin light chain A(Clta)

Recombinant Mouse Clathrin light chain A(Clta)

ArtNr	CSB-MP005591MO-100
Hersteller	Cusabio
Menge	100 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug
Kategorie	Neuroscience Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Mammalian cells
Konjugat/Tag	FLAG, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAF LAQQESEIAGIENDEAFAILDGGAPGRATRRAAGG PDAVDGVMNGEYYQESNGPTDSYAAISEVDRLQSE PESIRKWREEQTERLEALDANSRKQEAEWKEKAIK ELEEWYARQDEQLQKTKANNRVADEAFYKQPFADL IGYVAAEEAFVNDIDESSPGTEWERVARLCDFNPK SSKQAKDVSRMRSVLISLKQAPLVH
Protein Familie	Clathrin light chain family
Citations	SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged and Flag-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	31.1 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance	Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.
Expression Region	1-235aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge (By similarity).
Subcellular Location	Cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Membrane, coated pit, Peripheral membrane protein, Cytoplasmic side, Cytoplasm, cytoskeleton, spindle
Gene Names	Clta
Sequence Info	Full Length
Organism	Mus musculus (Mouse)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP005591MO-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 04.09.2025