Vergleich

Recombinant Human Tripartite motif-containing protein 72(TRIM72)

ArtNr CSB-MP744394HU-100
Hersteller Cusabio
Menge 100 ug
Quantity options 10 ug 100 ug 20 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Mammalian cells
Konjugat/Tag FLAG, Myc
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCR ACLGRVAGEPAADGTVLCPCCQAPTRPQALSTNLQ LARLVEGLAQVPQGHCEEHLDPLSIYCEQDRALVC GVCASLGSHRGHRLLPAAEAHARLKTQLPQQKLQL QEACMRKEKSVAVLEHQLVEVEETVRQFRGAVGEQ LGKMRVFLAALEGSLDREAERVRGEAGVALRRELG SLNSYLEQLRQMEKVLEEVADKPQTEFLMKYCLVT SRL
Protein Familie TRIM/RBCC family
Citations S-nitrosylation of TRIM72 at cysteine 144 is critical for protection against oxidation-induced protein degradation and cell death.
Kohr M.J., Evangelista A.M., Ferlito M., Steenbergen C., Murphy E.J. Mol. Cell. Cardiol. 69:67-74(2014)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Mitsugumin-53;Mg53
Lieferbar
Manufacturer - Conjugate / Tag
C-terminal Flag-Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
32.5 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Cell Biology
Relevance
Muscle-specific protein that plays a central role in cell membrane repair by nucleating the assembly of the repair machinery at injury sites. Specifically binds phosphatidylserine. Acts as a sensor of oxidation: upon membrane damage, entry of extracellular oxidative environment results in disulfide bond formation and homooligomerization at the injury site. This oligomerization acts as a nucleation site for recruitment of TRIM72-containing vesicles to the injury site, leading to membrane patch formation. Probably acts upstream of the Ca2+-dependent membrane resealing process. Required for transport of DYSF to sites of cell injury during repair patch formation. Regulates membrane budding and exocytosis. May be involved in the regulation of the mobility of KCNB1-containing endocytic vesicles
Expression Region
1-269aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Muscle-specific protein that plays a central role in cell membrane repair by nucleating the assembly of the repair machinery at injury sites. Specifically binds phosphatidylserine. Acts as a sensor of oxidation
Subcellular Location
Cell membrane, sarcolemma, Cytoplasmic vesicle membrane
Gene Names
TRIM72
Sequence Info
Full Length of Isoform 2
Organism
Homo sapiens (Human)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen