Vergleich

Recombinant Human Fc receptor-like protein 4 (FCRL4)

ArtNr CSB-MP836277HU-100
Hersteller Cusabio
Menge 100 ug
Quantity options 10 ug 100 ug 1 mg 20 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Mammalian cells
Konjugat/Tag Myc, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AHKPVISVHPPWTTFFKGERVTLTCNGFQFYATEK TTWYHRHYWGEKLTLTPGNTLEVRESGLYRCQARG SPRSNPVRLLFSSDSLILQAPYSVFEGDTLVLRCH RRRKEKLTAVKYTWNGNILSISNKSWDLLIPQASS NNNGNYRCIGYGDENDVFRSNFKIIKIQELFPHPE LKATDSQPTEGNSVNLSCETQLPPERSDTPLHFNF FRDGEVILSDWSTYPELQLPTVWRENSGSYWCGAE TVR
Citations IRTA1 and IRTA2, novel immunoglobulin superfamily receptors expressed in B cells and involved in chromosome 1q21 abnormalities in B cell malignancy.Hatzivassiliou G., Miller I., Takizawa J., Palanisamy N., Rao P.H., Iida S., Tagawa S., Taniwaki M., Russo J., Neri A., Cattoretti G., Clynes R., Mendelsohn C., Chaganti R.S.K., Dalla-Favera R.Immunity 14:277-289(2001)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Fc receptor homolog 4; Short name:; FcRH4; IFGP family protein 2; Short name:; hIFGP2; Immune receptor translocation-associated protein 1; CD_antigen: CD307d
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
45.6 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Immunology
Relevance
May function as an inhibitor of the B-cell receptor signaling. May function in the B-cell-mediated immune response.
Expression Region
20-387aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
May function as an inhibitor of the B-cell receptor signaling. May function in the B-cell-mediated immune response.
Subcellular Location
Cell membrane, Single-pass type I membrane protein
Tissue Specificity
Specifically expressed by memory and monocytoid B-cells which populate spleen and lymph nodes. Preferentially expressed in memory B-cells associated with mucosal tissue (at protein level).
Involvement in disease
A chromosomal aberration involving FCRL4 is found in non-Hodgkin lymphoma (NHG). Translocation t(1; 1)(p36.3; q21.1-2).
Gene Names
FCRL4
Sequence Info
Full Length of Mature Protein
Organism
Homo sapiens (Human)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen