« Zurück
Startseite /
Recombinant Chicken Vitellogenin-2(VTG2),partial

Recombinant Chicken Vitellogenin-2(VTG2),partial

ArtNr	CSB-RP163694c(A3)-100
Hersteller	Cusabio
Menge	100 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Kategorie	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	SRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKI TQVISSCFTRLFKFEYSSGRIGNIYAPEDCPDLCV NIVRGILNMFQMTIKKSQNVYELQEAGIGGICHAR YVIQEDRKNSRIYVTRTVDLNNCQEKVQKSIGMAY IYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITD VSSRQVYQISPFNEPTGVAVMEARQQLTLVEVRSE RGS
Citations	Nucleotide sequence of a chicken vitellogenin gene and derived amino acid sequence of the encoded yolk precursor protein.van Het Schip A.D., Samallo J., Broos J., Ophuis J., Mojet M., Gruber M., Ab G.J. Mol. Biol. 196:245-260(1987)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Major vitellogeninVitellogenin II
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	74.9 kDa
General Research Areas	Signal Transduction
Relevance	Precursor of the major egg-yolk proteins that are sources of nutrients during early development of oviparous organisms.Phosvitin is believed to be of importance in sequestering calcium, iron and other cations for the developing bryo.
Expression Region	26-653aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Precursor of the major egg-yolk proteins that are sources of nutrients during early development of oviparous organisms.; FUNCTION
Tissue Specificity	After incorporation from serum via a specific receptor, it is cleaved into four fragments, heavy and light chain lipovitellins, phosphovitin and YGP40, and YGP40 is released into the yolk plasma before or during compartmentation of lipovitellin-phosvitin complex into the yolk granule.
Gene Names	VTG2
Sequence Info	Partial
Organism	Gallus gallus (Chicken)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern