Vergleich

Recombinant Human Fibroblast growth factor receptor 1(FGFR1),partial

ArtNr CSB-YP008642HUa4-10
Hersteller Cusabio
Menge 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Konjugat/Tag HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCR LRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDS VPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSE DDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKM EKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKE FKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCI VENEYGSINHTYQLDVVERSPHRPILQAGLPANKT VAL
Protein Familie Protein kinase superfamily, Tyr protein kinase family, Fibroblast growth factor receptor subfamily
Citations "Alternative splicing generates at least five different isoforms of the human basic-FGF receptor."
Eisemann A., Ahn J.A., Graziani G., Tronick S.R., Ron D.
Oncogene 6:1195-1202(1991)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Basic fibroblast growth factor receptor 1; Short name:; BFGFR; Short name:; bFGF-R-1; Fms-like tyrosine kinase 2; Short name:; FLT-2; N-sam; Proto-oncogene c-Fgr; CD_antigen: CD331; BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-sumostar-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
55.4 kDa
General Research Areas
Cancer
Relevance
Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration. Required for normal mesoderm patterning and correct axial organization during embryonic development, normal skeletogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Phosphorylates PLCG1, FRS2, GAB1 and SHB. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1, 4, 5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Promotes phosphorylation of SHC1, STAT1 and PTPN11/SHP2. In the nucleus, enhances RPS6KA1 and CREB1 activity and contributes to the regulation of transcription. FGFR1 signaling is down-regulated by IL17RD/SEF, and by FGFR1 ubiquitination, internalization and degradation.
Expression Region
22-376aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration. Required for normal mesoderm patterning and correct axial organization during embryonic development, normal skeletogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Phosphorylates PLCG1, FRS2, GAB1 and SHB. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1, 4, 5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Promotes phosphorylation of SHC1, STAT1 and PTPN11/SHP2. In the nucleus, enhances RPS6KA1 and CREB1 activity and contributes to the regulation of transcription. FGFR1 signaling is down-regulated by IL17RD/SEF, and by FGFR1 ubiquitination, internalization and degradation.
Subcellular Location
Cell membrane, Single-pass type I membrane protein, Nucleus, Cytoplasm, cytosol, Cytoplasmic vesicle
Tissue Specificity
Detected in astrocytoma, neuroblastoma and adrenal cortex cell lines. Some isoforms are detected in foreskin fibroblast cell lines, however isoform 17, isoform 18 and isoform 19 are not detected in these cells.
Involvement in disease
Pfeiffer syndrome (PS); Hypogonadotropic hypogonadism 2 with or without anosmia (HH2); Osteoglophonic dysplasia (OGD); Hartsfield syndrome (HRTFDS); Trigonocephaly 1 (TRIGNO1); Encephalocraniocutaneous lipomatosis (ECCL); Jackson-Weiss syndrome (JWS)
Paythway
MAPKsignalingpathway
Gene Names
FGFR1
Sequence Info
Partial
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen