« Zurück
Startseite /
Recombinant Helicobacter pylori Bacterial non-heme ferritin(ftnA)

Recombinant Helicobacter pylori Bacterial non-heme ferritin(ftnA)

ArtNr	CSB-YP009053HUV-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHS LDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQL TSISAPEHKFEGLTQIFQKAYEHEQHISESINNIV DHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDK IELIGNENHGLYLADQYVKGIAKSRKS
Protein Familie	Ferritin family, Prokaryotic subfamily
Citations	"Paracrystalline inclusions of a novel ferritin containing nonheme iron, produced by the human gastric pathogen Helicobacter pylori: evidence for a third class of ferritins." Frazier B.A., Pfeifer J.D., Russell D.G., Falk P., Olsen A.N., Hammar M., Westblom T.U., Normark S.J. J. Bacteriol. 175:966-972(1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	pfr
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	21.8 kDa
Relevance	Iron-storage protein.
Expression Region	1-167aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Iron-storage protein.
Subcellular Location	Cytoplasm
Gene Names	ftnA
Sequence Info	Full length
Organism	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP009053HUV-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern