« Zurück
Startseite /
Recombinant Human Peroxisomal multifunctional enzyme type 2(HSD17B4)

Recombinant Human Peroxisomal multifunctional enzyme type 2(HSD17B4)

ArtNr	CSB-YP010774HU-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MGSPLRFDGRVVLVTGAGAGLGRAYALAFAERGAL VVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAV ANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRD RSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKK QKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLA NSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLV EALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIG KLR
Protein Familie	Short-chain dehydrogenases/reductases (SDR) family
Citations	"The DNA sequence and comparative analysis of human chromosome 5."Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	17-beta-hydroxysteroid dehydrogenase 4; Short name:; 17-beta-HSD 4; D-bifunctional protein; Short name:; DBP; Multifunctional protein 2; Short name:; MPF-2; Short chain dehydrogenase/reductase family 8C member 1; Cleaved into the following 2 chains:; (3R)-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.n12); Enoyl-CoA hydratase 2 (EC:4.2.1.107, EC:4.2.1.119); Alternative name(s):; 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	81.7 kDa
General Research Areas	Cancer
Relevance	Bifunctional enzyme acting on the peroxisomal beta-oxidation pathway for fatty acids. Catalyzes the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-branched-chain fatty acids
Expression Region	1-736aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Bifunctional enzyme acting on the peroxisomal beta-oxidation pathway for fatty acids. Catalyzes the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-branched-chain fatty acids.
Subcellular Location	Peroxisome
Tissue Specificity	Present in many tissues with highest concentrations in liver, heart, prostate and testis.
Involvement in disease	D-bifunctional protein deficiency (DBPD); Perrault syndrome 1 (PRLTS1)
Gene Names	HSD17B4
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP010774HU-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern