« Zurück
Startseite /
Recombinant Human Oxytocin-neurophysin 1(OXT),partial

Recombinant Human Oxytocin-neurophysin 1(OXT),partial

ArtNr	CSB-YP017315HU-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Skin Cancer Uterine, Ovarian & Cervical Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCF VGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVL GLCCSPDGCHADPACDAEATFSQR
Protein Familie	Vasopressin/oxytocin family
Citations	"The neurohypophyseal hormones vasopressin and oxytocin. Precursor structure, synthesis and regulation." Rehbein M., Hillers M., Mohr E., Ivell R., Morley S., Schmale H., Richter D. Biol. Chem. Hoppe-Seyler 367:695-704(1986)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Ocytocin
Lieferbar
Manufacturer - Targets	OXT
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	11.6 kDa
Relevance	Neurophysin 1 specifically binds oxytocin. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland.
Expression Region	32-125aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Neurophysin 1 specifically binds oxytocin.; FUNCTION
Subcellular Location	Secreted
Biologically active	Not Test
Protein length	Partial

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP017315HU-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern